POGLUT3 Rabbit Polyclonal Antibody

SKU TA337373

Rabbit Polyclonal Anti-KDELC2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KDELC2 antibody is: synthetic peptide directed towards the C-terminal region of Human KDELC2. Synthetic peptide located within the following region: DLLEKVKWAKENDEEAKKIAKEGQLMARDLLQPHRLYCYYYQVLQKYAER
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: KDEL motif containing 2
• Database Link:
  NP_714916
  Q7Z4H8
• Background: The function of this protein remains unknown.
• Synonyms: MGC33424
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Zebrafish: 83%

Reference Data