CREB3L2 Rabbit Polyclonal Antibody

CAT#: TA337284

Rabbit Polyclonal Anti-CREB3L2 Antibody

Product Images

WB Suggested Anti-CREB3L2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: CREB3L2; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CREB3L2; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CREB3L2; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CREB3L2; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Human kidney

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cAMP responsive element binding protein 3-like 2
• Database Link:
  NP_919047
  Entrez Gene 64764 Human
  UniProt ID Q70SY1
• Background: CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
• Synonyms: BBF2H7
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 87%; Rat: 87%; Horse: 87%; Rabbit: 87%; Guinea pig: 87%; Mouse: 86%; Dog: 85%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Melanogenesis, Prostate cancer