CREB3L2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 57 kDa |
| Gene Name | cAMP responsive element binding protein 3-like 2 |
| Database Link | |
| Background | CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138). |
| Synonyms | BBF2H7 |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 87%; Rat: 87%; Horse: 87%; Rabbit: 87%; Guinea pig: 87%; Mouse: 86%; Dog: 85% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins, Transciption Factors |
| Protein Families | Transcription Factors |
| Protein Pathways | Huntington's disease, Melanogenesis, Prostate cancer |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.