Twist (TWIST1) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TWIST1 antibody: synthetic peptide directed towards the C terminal of human TWIST1. Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 21 kDa |
| Gene Name | twist family bHLH transcription factor 1 |
| Database Link | |
| Background | Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation.TWIST1 is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. |
| Synonyms | ACS3; bHLHa38; BPES2; BPES3; CRS; CRS1; CSO; SCS; TWIST |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Dog: 79%; Rabbit: 79%; Guinea pig: 79% |
| Reference Data | |
| Protein Categories | Cytokines, Growth Factors, Intracellular Proteins, Transciption Factors |
| Protein Families | Druggable Genome |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Overexpression of PEAK1 contributes to epithelial-mesenchymal transition and tumor metastasis in lung cancer through modulating ERK1/2 and JAK2 signaling
Ding, Tang, Fan et al
Cell Death Dis (2018) 9 (8), 802 DOI: 10.1038/s41419-018-0817-1
Ding, Tang, Fan et al
Cell Death Dis (2018) 9 (8), 802 DOI: 10.1038/s41419-018-0817-1
AI Summary: OriGene products, specifically antibodies against p-JAK1, total JAK1, p-JAK2, total JAK2, Twist1, Twist2, Snail1, Snail2, Zeb1, and Zeb2, were used in this study to detect and analyze key proteins involved in signaling pathways and epithelial-mesenchymal transition related to PEAK1-driven lung cancer progression and metastasis.
Snippet: ge of three independent experiments ± SEM. *P ;The primary antibodies used in our study were as follows: PEAK1 (Santa Cruz Biotechnology, USA);PEAK1/NKF3, E-cadherin, N-cadherin, MMP2, and MMP9 (Abcam, UK);p-AKT, total AKT, p-ERK1/2, total ERK1/2, p-JNK and total JNK (Invitrogen, USA);p-Rac1, total Rac1, p-JAK1, total JAK1, p-JAK2, total JAK2, Twist1" style="font-weight: bold;">Twist1, Twist2" style="font-weight: bold;">Twist2, Snail1, Snail2, Zeb1, and Zeb2 (OriGene, USA);and GAPDH (Immunology Consultants Laboratory, USA). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
