galectin 9 (LGALS9) Rabbit Polyclonal Antibody

SKU TA334422

Rabbit Polyclonal Anti-LGALS9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LGALS9 antibody: synthetic peptide directed towards the middle region of human LGALS9. Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: galectin 9
• Database Link:
  NP_033665
  O00182
• Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. This galectin is strongly overexpressed in Hodgkin's disease tissue and it might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its consistently associated immunodeficiency. The protein has N- and C- terminal carbohydrate-binding domains connected by a link peptide. Multiple alternatively spliced transcript variants have been found for this gene.
• Synonyms: HUAT; LGALS9A
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Rat: 83%; Mouse: 83%; Rabbit: 79%

Reference Data