PRAME Rabbit Polyclonal Antibody

SKU TA333925

Rabbit Polyclonal Anti-PRAME Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRAME Antibody: synthetic peptide directed towards the N terminal of human PRAME. Synthetic peptide located within the following region: AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: preferentially expressed antigen in melanoma
• Database Link:
  NP_006106
  P78395
• Background: PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.This gene encodes an antigen that is predominantly expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. This expression pattern is similar to that of other CT antigens, such as MAGE, BAGE and GAGE. However, unlike these other CT antigens, this gene is also expressed in acute leukemias. Five alternatively spliced transcript variants encoding the same protein have been observed for this gene.
• Synonyms: CT130; MAPE; OIP-4; OIP4
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%; Horse: 79%; Rabbit: 79%

Reference Data