HIC5 (TGFB1I1) Rabbit Polyclonal Antibody

SKU TA333787

Rabbit Polyclonal Anti-TGFB1I1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TGFB1I1 Antibody is: synthetic peptide directed towards the middle region of Human TGFB1I1. Synthetic peptide located within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: transforming growth factor beta 1 induced transcript 1
• Database Link:
  NP_057011
  O43294
• Background: The TGFB1I1 gene encodes a protein that is a key element in the transduction of signals from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer.
• Synonyms: ARA55; HIC-5; HIC5; TSC-5
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Goat: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors