Phospholipase C beta 1 (PLCB1) Rabbit Polyclonal Antibody

SKU TA333384

Rabbit Polyclonal Anti-PLCB1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 134 kDa
• Gene Name: phospholipase C beta 1
• Database Link:
  NP_877398
  Q9NQ66
• Background: The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction
• Synonyms: EIEE12; PI-PLC; PLC-154; PLC-I; PLC154; PLCB1A; PLCB1B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Calcium signaling pathway, Chemokine signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Inositol phosphate metabolism, Long-term depression, Long-term potentiation, Melanogenesis, Metabolic pathways, Phosphatidylinositol signaling system, Vascular smooth muscle contraction, Wnt signaling pathway