GALK2 Rabbit Polyclonal Antibody

SKU TA331254

Rabbit Polyclonal Anti-GALK2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GALK2 antibody is: synthetic peptide directed towards the C-terminal region of Human GALK2. Synthetic peptide located within the following region: TVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: galactokinase 2
• Database Link:
  NP_002035
  Q01415
• Background: This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: GK2
• Note: Human: 100%; Horse: 93%; Bovine: 86%; Pig: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways