FLVCR2 Rabbit Polyclonal Antibody

SKU
TA331252
Rabbit Polyclonal Anti-FLVCR2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FLVCR2 antibody is: synthetic peptide directed towards the C-terminal region of Human FLVCR2. Synthetic peptide located within the following region: CVFLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name feline leukemia virus subgroup C cellular receptor family member 2
Database Link
Background This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.
Synonyms C14orf58; CCT; EPV; FLVCRL14q; MFSD7C; PVHH
Note Human: 100%; Dog: 93%; Pig: 93%; Horse: 86%; Rabbit: 79%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:FLVCR2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.