FYN Rabbit Polyclonal Antibody

SKU TA330932

Rabbit polyclonal Anti-FYN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FYN antibody: synthetic peptide directed towards the middle region of human FYN. Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: FYN proto-oncogene, Src family tyrosine kinase
• Database Link:
  NP_002028
  P06241
• Background: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.
• Synonyms: p59-FYN; SLK; SYN
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Adherens junction, Axon guidance, Fc epsilon RI signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, Pathogenic Escherichia coli infection, Prion diseases, T cell receptor signaling pathway, Viral myocarditis