Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 50 kDa |
Gene Name | ribonuclease/angiogenin inhibitor 1 |
Database Link | |
Background | RNH1 is the inhibitor of pancreatic RNase and angiogenin. RNH1 may also function in the modulation of cellular activities. |
Synonyms | RAI; RNH |
Note | Rat: 100%; Human: 100%; Horse: 93%; Mouse: 77% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.