Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

SKU TA330921

Rabbit Polyclonal Anti-RNH1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: ribonuclease/angiogenin inhibitor 1
• Database Link:
  NP_002930
  P13489
• Background: RNH1 is the inhibitor of pancreatic RNase and angiogenin. RNH1 may also function in the modulation of cellular activities.
• Synonyms: RAI; RNH
• Note: Rat: 100%; Human: 100%; Horse: 93%; Mouse: 77%

Reference Data