Nkx2.2 (NKX2-2) Rabbit Polyclonal Antibody

SKU TA330256

Rabbit Polyclonal Anti-NKX2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NKX2-2 antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: NK2 homeobox 2
• Database Link:
  NP_002500
  O95096
• Background: Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.
• Synonyms: NKX2.2; NKX2B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%; Rabbit: 92%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young