ZGPAT Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the C terminal of human ZGPAT. Synthetic peptide located within the following region: AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 57 kDa |
Gene Name | zinc finger CCCH-type and G-patch domain containing |
Database Link | |
Background | ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known. |
Synonyms | GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 79%; Rabbit: 79% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.