EMX2 Rabbit Polyclonal Antibody

SKU TA329368

Rabbit Polyclonal anti-EMX2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EMX2 antibody is: synthetic peptide directed towards the N-terminal region of Human EMX2. Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: empty spiracles homeobox 2
• Database Link:
  NP_004089
  Q04743
• Background: The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head.
• Synonyms: empty spiracles homeobox 2; empty spiracles homolog 2; OTTHUMP00000020578
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome