EMX2 Rabbit Polyclonal Antibody
Product Data | |
Application | IHC, WB |
---|---|
Recommended Dilution | WB, IHC |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-EMX2 antibody is: synthetic peptide directed towards the N-terminal region of Human EMX2. Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 28 kDa |
Gene Name | empty spiracles homeobox 2 |
Database Link | |
Background | The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head. |
Synonyms | empty spiracles homeobox 2; empty spiracles homolog 2; OTTHUMP00000020578 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.