Germany
Japan
United Kingdom
China
ZCCHC7 (Myc-DDK-tagged)-Human zinc finger, CCHC domain containing 7 (ZCCHC7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Liver Diseases
View as table Download
Lenti ORF particles, ZCCHC7 (Myc-DDK tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ZCCHC7 (mGFP-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ZCCHC7 (myc-DDK-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZCCHC7 (myc-DDK-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZCCHC7 (myc-DDK-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZCCHC7 (tGFP-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZCCHC7 (tGFP-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZCCHC7 (tGFP-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ZCCHC7 (tGFP-tagged) - Human zinc finger, CCHC domain containing 7 (ZCCHC7), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human zinc finger, CCHC domain containing 7 (ZCCHC7), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-ZCCHC7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZCCHC7 antibody: synthetic peptide directed towards the C terminal of human ZCCHC7. Synthetic peptide located within the following region: KNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHYH |
Purified recombinant protein of Human zinc finger, CCHC domain containing 7 (ZCCHC7), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human enolase 1, (alpha) (ENO1), transcript variant 1, 1Met-421Ala, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
ZCCHC7 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZCHC7 |
Active filters
Pathways
- RNA degradation