Goat Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Goat Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Desmin (DES) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Goat, Hamster, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Chicken gizzard muscle Desmin. Desmin was purified from a crude tissue preparation by preparative gel electrophoresis as described in Reference 1. |
Desmin mouse monoclonal antibody, clone RD301, Purified
| Applications | IF, IHC, WB |
| Reactivities | Canine, Chicken, Hamster, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
USD 380.00
4 Weeks
Mouse Monoclonal Anti-alpha-Tubulin Antibody [2B11]
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Zebrafish |
| Conjugation | Biotin |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
Germany
Japan
United Kingdom
China
