Rabbit Polyclonal SDHB Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human SDHB protein (within residues 1-150). [Swiss-Prot P21912] |
Rabbit Polyclonal SDHB Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human SDHB protein (within residues 1-150). [Swiss-Prot P21912] |
Rabbit Polyclonal IDH2 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human IDH2 protein (between residues 375-452) [UniProt P48735]. |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Rabbit Polyclonal Anti-IDH3B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IDH3B |
FH (176-189) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Chicken, Drosophila, Equine, Hamster, Insect, Monkey, Porcine, Sheep, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human FH |
Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))
Applications | IF, WB |
Reactivities | Human (Predicted: Rat, Pig, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912) |
Rabbit Polyclonal IDH2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2. |
Rabbit Polyclonal Anti-IDH3A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the N terminal of human IDH3A. Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK |
Rabbit Polyclonal Anti-FH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FH |
Rabbit Polyclonal Anti-DLAT Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR |
Rabbit polyclonal anti-PDHA1 antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDHA1. |
Anti-ACO2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 766-780 amino acids of human aconitase 2, mitochondrial |
Rabbit polyclonal PC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PC. |
Rabbit anti-PDHA1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDHA1 |
Rabbit Polyclonal Anti-PC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL |