Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody
Product Data | |
Application | IHC, WB |
---|---|
Recommended Dilution | WB, IHC |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 69 kDa |
Gene Name | dihydrolipoamide S-acetyltransferase |
Database Link | |
Background | DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC; EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC; MIM 109720) show autoantibodies to DLAT. [supplied by OMIM] |
Synonyms | DLTA; PDC-E2; PDCE2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.