Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Rabbit Polyclonal Antibody against Carbonic Anhydrase IX
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from a C-terminal sequence of the human CA IX. |
Goat Anti-Calnexin Antibody
| Applications | IF, IHC, PEP-ELISA, WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKTPELNLDQFHDKT, from the internal region (near N-Terminus) of the protein sequence according to NP_001737.1. |
Goat Polyclonal Antibody against HCRTR1
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1. |
Rabbit Polyclonal antibody to BCL-x (BCL2-like 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 208 of Bcl-X (Uniprot ID#Q07817) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit Polyclonal antibody to Ribosome binding protein 1 (ribosome binding protein 1 homolog 180kDa (dog))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1183 and 1410 of Ribosome binding protein 1 (Uniprot ID#Q9P2E9) |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Dog, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit Polyclonal Anti-KCNK13 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA |
Goat Polyclonal Antibody against Leptin Receptor
| Applications | FC, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TQDDIEKHQSDAG, from the internal region of the protein sequence according to NP_002294.2; NP_001003679.1; NP_001003680.1. |
Rabbit Polyclonal antibody to TRAM1 (translocation associated membrane protein 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Dog, Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 310 and 374 of TRAM1 (Uniprot ID#Q15629) |
Rabbit Polyclonal antibody to Caveolin 2 (caveolin 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Rat, Dog, Feline, Pig, Rabbit, Sheep, Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Caveolin 2 |
Goat Anti-SERCA2 / ATP2A2 Antibody
| Applications | IF, IHC, PEP-ELISA, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DELNPSAQRDACLN, from the internal region of the protein sequence according to NP_001672.1; NP_733765.1. |
Goat Polyclonal Antibody against ITGAM
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RNDGEDSYRTQ, from the internal region of the protein sequence according to NP_000623.2. |
Goat Anti-CD11A / integrin alpha L Antibody
| Applications | FC, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YQVRIQPSIHDHN, from the internal region of the protein sequence according to NP_002200.2; NP_001107852.1. |
Germany
Japan
United Kingdom
China
