KCNK13 Rabbit Polyclonal Antibody

SKU TA338706

Rabbit Polyclonal Anti-KCNK13 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC, IF
• Reactivity: Dog, Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: potassium two pore domain channel subfamily K member 13
• Database Link:
  NP_071337
  Q9HB14
• Background: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a potassium channel containing two pore-forming domains. This protein is an open channel that can be stimulated by arachidonic acid and inhibited by the anesthetic halothane. [provided by RefSeq, Jul 2013]
• Synonyms: K2p13.1; THIK-1; THIK1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Rat: 79%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane