Primary Antibodies

View as table Download

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK2

Anti-AMDHD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human amidohydrolase domain containing 2

Anti-AMDHD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human amidohydrolase domain containing 2

Rabbit Polyclonal Anti-GALK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GALK1

Rabbit polyclonal GCK Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

Rabbit Polyclonal Anti-TSTA3 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3. Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

GFPT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 181~210 amino acids from the Center region of human GFPT2 / GFAT2

Rabbit Polyclonal anti-CHIA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL

Rabbit Polyclonal Anti-HK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK1

Rabbit polyclonal antibody to UAP1 (UDP-N-acteylglucosamine pyrophosphorylase 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Xenopus, Zebrafish)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 53 and 473 of UAP1

Glucose 6 phosphate isomerase (GPI) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 452~481 amino acids from the C-terminal region of human GPI

Rabbit Polyclonal GNPDA2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen GNPDA2 antibody was raised against an 8 amino acid peptide near the carboxy terminus of human GNPDA2.

Rabbit polyclonal antibody to MPI (mannose phosphate isomerase)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 150 and 423 of MPI (Uniprot ID#P34949)

Rabbit Polyclonal antibody to PGM3 (phosphoglucomutase 3)

Applications IF, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 44 and 321 of PGM3 (Uniprot ID#O95394)