AMCase (CHIA) Rabbit Polyclonal Antibody

CAT#: TA329462

Rabbit Polyclonal anti-CHIA antibody

Product Images

WB Suggested Anti-CHIA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: CHIA; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: CHIA; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: CHIA; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: chitinase, acidic
• Database Link:
  NP_068569
  Entrez Gene 27159 Human
  UniProt ID Q9BZP6
• Background: CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
• Synonyms: AMCASE; CHIT2; TSA1902
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Horse: 86%; Zebrafish: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Amino sugar and nucleotide sugar metabolism