GFUS Rabbit Polyclonal Antibody

CAT#: TA344243

Rabbit Polyclonal Anti-TSTA3 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: TSTA3; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml; TSTA3 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• 

  Host: Rabbit; Target Name: TSTA3; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; TSTA3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  WB Suggested Anti-TSTA3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysateTSTA3 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Rabbit Anti-TSTA3 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3. Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: tissue specific transplantation antigen P35B
• Database Link:
  NP_003304
  Entrez Gene 7264 Human
  UniProt ID Q13630
• Background: Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.
• Synonyms: FX; P35B; SDR4E1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways