SARS-CoV-2 Spike S1 Recombinant Protein with His and Avi tag

CAT#: TP723916

Reviews ()
Write a review

SARS-CoV-2 Spike S1 Recombinant Protein with His and Avi tag



  View other "S Protein" proteins (19)

USD 358.00


Availability*
5 Days

Size
    • 100 ug


Product images

Specifications

Product Data
Description SARS-CoV-2 Spike S1 Recombinant Protein with His and Avi tag
Species SARS-CoV-2
Expression Host HEK293
Expression cDNA Clone or AA Sequence QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRR
Tag C-6xHis/AVI
Purity >95% by SDS-PAGE.
Buffer Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Endotoxin < 1.0 EU/μg of the protein by LAL method.
Protein Description Recombinant 2019-nCoV Spike S1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln14-Arg683) of 2019-ncov Spike S1 (Accession #YP_009724390.1) fused with a 6×His tag and Avi at the C-terminus.
Storage Store at -80°C.
Stability 3 months
Reference Data
Locus ID 43740568

Documents

Other Versions

Other products for "S Protein"
Frequently bought together (1)
SARS-CoV-2 Spike protein mouse monoclonal antibody, clone OTI1C2
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools
HUMAN PROREINS 101