Mdk (NM_010784) Mouse Recombinant Protein

CAT#: TP723299

Purified recombinant protein of Mouse midkine (Mdk), transcript variant 1.


 Product Datasheet for 'TP723299'

 Cited in 1 publication.

USD 230.00


Availability*
2 Weeks

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse midkine (Mdk), transcript variant 1.
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence VAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Tag Tag Free
Predicted MW 13.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human neutrophils using a concentration range of 10-100 ng/ml.
Cell treatment (PMID: 28489825)
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_034914
Locus ID 17242
Refseq Size 1077
Refseq ORF 423
Synonyms Mek; MK

Citations (1)

Documents

Frequently bought together (1)
MDK mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)
    • 100 ul

USD 360.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones