Csf1 (NM_001113529) Mouse Recombinant Protein

CAT#: TP723289

Reviews ()
Write a review

Purified recombinant protein of Mouse colony stimulating factor 1 (macrophage) (Csf1), transcript variant 2.


 Product Datasheet for 'TP723289'

  View other "Csf1" proteins (3)

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse colony stimulating factor 1 (macrophage) (Csf1), transcript variant 2.
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Tag Tag Free
Predicted MW 36.4 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity The ED50 as determined by the dose-dependent stimulation of the proliferation of M-NFS-60 cells is > 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_031804
Locus ID 12977
Refseq Size 3307
Refseq ORF 771
Synonyms C87615; Csfm; MCSF; op
Summary Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. [UniProtKB/Swiss-Prot Function]

Documents

Other Versions

Other products for "Csf1"
Frequently bought together (1)
Rabbit Polyclonal MCSF Antibody
    • 100 ug

USD 409.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101