IL1 beta (IL1B) (NM_000576) Human Recombinant Protein

CAT#: TP723210

Reviews ()
Write a review

Purified recombinant protein of Human interleukin 1, beta (IL1B).



  View other "IL1B" proteins (8)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human interleukin 1, beta (IL1B).
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Tag Tag Free
Predicted MW 17.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 as determined by the dose-dependent stimulation of thymidine uptake by murine D10S cells is less than or equal to 1.0 pg/ml, corresponding to a specific activity of > 1 x 10^9 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000567
Locus ID 3553
Refseq Size 1498
Cytogenetics 2q14.1
Refseq ORF 807
Synonyms IL-1; IL1-BETA; IL1F2
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Alzheimer's disease, Apoptosis, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, MAPK signaling pathway, NOD-like receptor signaling pathway, Prion diseases, Toll-like receptor signaling pathway, Type I diabetes mellitus

Documents

Other Versions

Other products for "IL1B"
Frequently bought together (1)
IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101