Il13 (NM_053828) Rat Recombinant Protein

CAT#: TP723189

Purified recombinant protein of Rat interleukin 13 (Il13).


 Product Datasheet for 'TP723189'

  View other "Il13" proteins (7)

Use code "PROTEIN10" to save 10%

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat interleukin 13 (Il13).
Species Rat
Expression Host E.Coli
Expression cDNA Clone or AA Sequence TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Tag Tag Free
Predicted MW 12.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by the dose-dependent proliferation of TF-1 cells is > 5.0 ng/ml, corresponding to a specific activity of > 2 x 10^5 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_446280
Locus ID 116553
Refseq Size 443
Refseq ORF 393

Documents

Other Versions

Other products for "Il13"
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies