FGF21 (NM_019113) Human Recombinant Protein

CAT#: TP723096

Purified recombinant protein of Human fibroblast growth factor 21 (FGF21).


 Product Datasheet for 'TP723096'

  View other "FGF21" proteins (5)

USD 230.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human fibroblast growth factor 21 (FGF21).
Species Human
Expression Host E.Coli
Expression cDNA Clone or AA Sequence MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Tag Tag Free
Predicted MW 19.5 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >90% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity FGF-21, in the absence of betaKlotho, shows weak activity of thymidine uptake by BaF3 cells expressing FGF receptors.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_061986
Locus ID 26291
Refseq Size 940
Cytogenetics 19q13.33
Refseq ORF 627
Synonyms fibroblast growth factor 21
Summary Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The encoded protein stimulates the uptake of glucose in adipose tissue. [provided by RefSeq, Mar 2016]
Protein Families Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma

Documents

Other Versions

Other products for "FGF21"
Frequently bought together (1)
FGF21 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
    • 100 ul

USD 360.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones