SARS-Cov-2 Spike RBD Recombinant Protein (MND908947)

CAT#: TP701142

Reviews ()
Write a review

Purified recombinant SARS coronavirus 2 Spike-RBD protein(Lys310~Leu560), with C-terminal Human Fc tag, secretory expressed in HEK293 cells, 50ug



  View other "SARS-CoV-2 Spike-RBD Protein" proteins (19)

USD 867.00


Availability*
In Stock

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant SARS coronavirus 2 Spike-RBD protein(Lys310~Leu560), with C-terminal Human Fc tag, secretory expressed in HEK293 cells, 50ug
Species SARS-CoV-2
Expression Host HEK293
Expression cDNA Clone or AA Sequence MALWIDRMQLLSCIALSLALVTNSAKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLGGGSGGGSPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Tag C-Fc Human
Predicted MW 56.1 KDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 95% as determined by SDS-PAGE and Coomassie blue staining
Buffer PBS,10% Glycerol
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq QHD43416

Documents

Other Versions

Other products for "SARS-CoV-2 Spike-RBD Protein"
Frequently bought together (1)
SARS-CoV-2 Spike protein mouse monoclonal antibody, clone OTI1C2
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools
HUMAN PROREINS 101