Tsen54 (NM_029557) Mouse Recombinant Protein

SKU TP527588

Purified recombinant protein of Mouse tRNA splicing endonuclease subunit 54 (Tsen54), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227588 representing NM_029557; Red=Cloning site Green=Tags(s); ; MEPEPEPGSVEVPAGRVLSASELRAARSRSQKLPQRSHGPKDFLPDGSEAQAERLRLCRQELWQLLAEER; VERLGSLVAAEWKPEEGFVELTSPAGKFWQTMGYSEEGRQRLHPEEALYLLECGSIQLFYQDLPLSIQEA; YQLLLTEDTLSFLQYQVFSHLKRLGYVVRRFQLSSVVSPYERQLNLDGYAQCLEDGSGKRKRSSSCRSVN; KKPKVLQNSLPPVSLAASSSPACDQSSQYPEEKSQDSSPRQGSELPLQFLGSSEPCSDLAREDVGCDRES; HKIENGAKGTPKLRWNFEQISFPNMASDSRHTFLPAPAPELLPANVIGRGTDAESWCQKLNQRREKLSRR; DREQQAVVQQFREDVNADPEVRGCSSWQEYKELLQRRQTQKSQPRPPHLWGQSVTPLLDPDKADCPAAVL; QHISVLQTTHLADGGYRLLEKSGGLQISFDVYQADAVATFRKNSPGKPYVRMCISGFDDPVPDLCSLKCL; TYQSGDVPLIFALVDHGDISFYSFRDFTLPRDLGH; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 59.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_083833
• Locus ID: 76265
• UniProt ID: Q8C2A2
• Cytogenetics: 11 E2
• RefSeq Size: 1972
• RefSeq ORF: 1575
• Synonyms: 0610034P02Rik
• Summary: Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events (By similarity).[UniProtKB/Swiss-Prot Function]