Sun3 (NM_177576) Mouse Recombinant Protein

SKU TP527552

Purified recombinant protein of Mouse Sad1 and UNC84 domain containing 3 (Sun3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227552 protein sequence; Red=Cloning site Green=Tags(s); ; MPKEQQELLKKESQTLENNFREILFLIEQIDVLKALLKDMKDGVHNHSLPVHRDAVQDQATTDVLDEEMS; NLVHYVLKKFRGDQIQLADYALKSAGASVIEAGTSESYKNNKAKLYWHGIGFLNYEMPPDMILQPDVHPG; KCWAFPGSQGHILIKLARKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGVMKKCEGEEIFLGQFIYNK; MEATIQTFELQNEASESLLCVKLQILSNWGHPKYTCLYRFRVHGIPSDYT; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_808244
• Locus ID: 194974
• UniProt ID: Q5SS91
• Cytogenetics: 11 A1
• RefSeq Size: 1205
• RefSeq ORF: 780
• Synonyms: Sunc1
• Summary: As a probable component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. May be involved in nuclear remodeling during sperm head formation in spermatogenenis. A probable SUN3:SYNE1 LINC complex may tether spermatid nuclei to posterior cytoskeletal structures such as the manchette.[UniProtKB/Swiss-Prot Function]