Cd207 (NM_144943) Mouse Recombinant Protein
SKU
TP527534
Purified recombinant protein of Mouse CD207 antigen (Cd207), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR227534 representing NM_144943
Red=Cloning site Green=Tags(s) MPEAEMKEEAPEAHFTVDKQNISLWPREPPPKQDLSPVLRKPLCICVAFTCLALVLVTSIVLQAVFYPRL MGKILDVKSDAQMLKGRVDNISTLGSDLKTERGRVDDAEVQMQIVNTTLKRVRSQILSLETSMKIANDQL QILTMSWGEVDSLSAKIPELKRDLDKASALNTKVQGLQNSLENVNKLLKQQSDILEMVARGWKYFSGNFY YFSRTPKTWYSAEQFCISRKAHLTSVSSESEQKFLYKAADGIPHWIGLTKAGSEGDWYWVDQTSFNKEQS RRFWIPGEPNNAGNNEHCANIRVSALKCWNDGPCDNTFLFICKRPYVQTTE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 38.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_659192 |
Locus ID | 246278 |
UniProt ID | Q8VBX4 |
Cytogenetics | 6 C3 |
RefSeq Size | 1530 |
RefSeq ORF | 993 |
Synonyms | Langerin |
Summary | Calcium-dependent lectin displaying mannose-binding specificity. Induces the formation of Birbeck granules (BGs); is a potent regulator of membrane superimposition and zippering. Binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. Facilitates uptake of antigens and is involved in the routing and/or processing of antigen for presentation to T cells.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.