Usp44 (NM_183199) Mouse Recombinant Protein

SKU
TP522450
Purified recombinant protein of Mouse ubiquitin specific peptidase 44 (Usp44), transcript variant 2, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR222450 representing NM_183199
Red=Cloning site Green=Tags(s)

MDRCKHVEQLQLAQGHSILDPQKWYCMVCNTTESIWACLSCSHVACGKYIQEHALKHFQESSHPVAFEVN
DMYAFCYLCNDYVLNDNAAGDLKSLRSTLSTIKSKKYPCVVPSDSVLHPVDAQDRVYSLLDGTQSLPGNE
DPTCAALWHRRRVLMGKAFRTWFEQSAIGRKGQEPTQERMVAKREAKRRQQQELEQQMKAELESTPPRKS
LRLQGSSEEAATIEIVPVRAPPPPPASPAKDKAALPTSEDRTFKKLDLNQWLAVAASDKARSYKHSAVTE
AAAQQMNEGQEKEKGFVCSRHSGLSSGLSGGASKGRNMELIQPREPSSPYSSLCHELHILFQVMWSGEWA
LVSPFAMLHSVWRLIPAFRGYAQQDAQEFLCELLDKIQRELETTGTKLPALIPTSQRRLIEQVLNVVNNI
FHGQFLSQVWMSCHIFIIFGNSYSAAYNWVFCMDRAWESWWHFSVRIDFFHECVKKSRISESLEIVLYLW
KQWLYGGESKENCIF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 58 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 327799
UniProt ID Q8C2S0
Cytogenetics 10 C2
RefSeq Size 2946
RefSeq ORF 1515
Synonyms E430004F17Rik
Summary Deubiquitinase that plays a key regulatory role in the spindle assembly checkpoint or mitotic checkpoint by preventing premature anaphase onset. Acts by specifically mediating deubiquitination of CDC20, a negative regulator of the anaphase promoting complex/cyclosome (APC/C). Deubiquitination of CDC20 leads to stabilize the MAD2L1-CDC20-APC/C ternary complex (also named mitotic checkpoint complex), thereby preventing premature activation of the APC/C. Promotes association of MAD2L1 with CDC20 and reinforces the spindle assembly checkpoint. Acts as a negative regulator of histone H2B (H2BK120ub1) ubiquitination.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Usp44 (NM_183199) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.