Stk25 (NM_021537) Mouse Recombinant Protein

CAT#: TP506799

Purified recombinant protein of Mouse serine/threonine kinase 25 (yeast) (Stk25), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206799 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHLRGFAHQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVL
  SQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRD
  IKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAK
  GEPPNSDLHPMRVLFLIPKNNPPTLEGHHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFL
  TELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPIK
  RQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHSRN
  HLTSTR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 48.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067512
• Locus ID: 59041
• UniProt ID: Q9Z2W1, Q3U6Y0
• Cytogenetics: 1 47.25 cM
• Refseq Size: 3254
• Refseq ORF: 1281
• Synonyms: 1500019J11Rik; AU018434; C86992; Ste20-like; Ysk1
• Summary: Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important for cell migration (By similarity).[UniProtKB/Swiss-Prot Function]