Lipa (NM_001111100) Mouse Recombinant Protein

SKU
TP506231
Purified recombinant protein of Mouse lysosomal acid lipase A (Lipa), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206231 representing NM_001111100
Red=Cloning site Green=Tags(s)

MQLQGLVFVFTIGILLSRVPTGTVSAVDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGRKN
HFGKGPRPVVYLQHGLLADSSNWVTNIDNSSLGFLLADAGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAF
SFDEMAKYDLPASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAPVLSLNFASGP
LLQLGRLPDPLLKDMFGQKQFLPQSAMLKWLSIHVCTHVIMKELCANVFFLLCGFNEKNLNMSRVDVYTT
HCPAGTSVQNMLHWGQVFKYRKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLADIND
ITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001104570
Locus ID 16889
UniProt ID Q9Z0M5
Cytogenetics 19 C1
RefSeq Size 2987
RefSeq ORF 1191
Synonyms AA960673; Lal; Lip-1; Lip1
Summary Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Lipa (NM_001111100) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.