Uchl1 (NM_011670) Mouse Recombinant Protein

SKU TP502576

Purified recombinant protein of Mouse ubiquitin carboxy-terminal hydrolase L1 (Uchl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202576 representing NM_011670; Red=Cloning site Green=Tags(s); ; MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRKKQIEEL; KGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQ; AAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDSLLQDAAKVCREFTEREQG; EVRFSAVALCKAA; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 25.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_035800
• Locus ID: 22223
• UniProt ID: Q9R0P9
• Cytogenetics: 5 35.95 cM
• RefSeq Size: 1156
• RefSeq ORF: 669
• Synonyms: AW822034; C88048; gad; PGP 9.5; PGP9.5; R75593; UCH-L1; UCHL-1
• Summary: Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins (Probable). This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin (PubMed:12913066). Also binds to free monoubiquitin and may prevent its degradation in lysosomes (PubMed:12913066). The homodimer may have ATP-independent ubiquitin ligase activity (By similarity).[UniProtKB/Swiss-Prot Function]