Mgmt (NM_008598) Mouse Recombinant Protein

CAT#: TP502297

Purified recombinant protein of Mouse O-6-methylguanine-DNA methyltransferase (Mgmt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202297 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAETCKMKYSVLDSPLGKMELSDCERGLHGIRLLSGKTPNTDPTEAPATPEVLGGPEGVPEPLVQCTAWL
  EAYFREPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRS
  NPVPILIPCHRVVRSDGAIGHYSGGGQAVKEWLLAHEGIPTGQPASKGLGLTGTWLKSSFESTSSEPSGR
  N
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032624
• Locus ID: 17314
• UniProt ID: P26187, Q4VA39
• Cytogenetics: 7 82.07 cM
• Refseq Size: 857
• Refseq ORF: 636
• Synonyms: Agat; AGT; AI267024
• Summary: Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.[UniProtKB/Swiss-Prot Function]