Mgmt (NM_008598) Mouse Recombinant Protein
CAT#: TP502297
Purified recombinant protein of Mouse O-6-methylguanine-DNA methyltransferase (Mgmt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Mgmt"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202297 protein sequence
Red=Cloning site Green=Tags(s) MAETCKMKYSVLDSPLGKMELSDCERGLHGIRLLSGKTPNTDPTEAPATPEVLGGPEGVPEPLVQCTAWL EAYFREPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRS NPVPILIPCHRVVRSDGAIGHYSGGGQAVKEWLLAHEGIPTGQPASKGLGLTGTWLKSSFESTSSEPSGR N myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032624 |
Locus ID | 17314 |
UniProt ID | P26187, Q4VA39 |
Cytogenetics | 7 82.07 cM |
Refseq Size | 857 |
Refseq ORF | 636 |
Synonyms | Agat; AGT; AI267024 |
Summary | Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.