HEF1 (NEDD9) (NM_001142393) Human Recombinant Protein

SKU
TP327437
Recombinant protein of human neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227437 representing NM_001142393
Red=Cloning site Green=Tags(s)

MWTRNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQET
ASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQR
SIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKP
QGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYN
CDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
NPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQ
RVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPG
PGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGLSKEQAPDCSSSDGSERSWMDDYD
YVHLQGKEEFERQQKELLEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGV
SAQDRQLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQ
DIRNKVMNSSNQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 92.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001135865
Locus ID 4739
UniProt ID Q14511
Cytogenetics 6p24.2
RefSeq ORF 2502
Synonyms CAS-L; CAS2; CASL; CASS2; HEF1
Summary The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:HEF1 (NEDD9) (NM_001142393) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307200 NEDD9 MS Standard C13 and N15-labeled recombinant protein (NP_006394) 10 ug
$3,255.00
PH327437 NEDD9 MS Standard C13 and N15-labeled recombinant protein (NP_001135865) 10 ug
$3,255.00
LC401924 NEDD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428064 NEDD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401924 Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 1 100 ug
$436.00
LY428064 Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 3 100 ug
$665.00
TP307200 Recombinant protein of human neural precursor cell expressed, developmentally down-regulated 9 (NEDD9), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.