CSRP3 (NM_001127656) Human Recombinant Protein
CAT#: TP325217
Recombinant protein of human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2, 20 µg
View other "CSRP3" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225217 protein sequence
Red=Cloning site Green=Tags(s) MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Enzyme substrate (PMID: 27281159) Binding assay (PMID: 27281159) Co-immunoprecipitation (PMID: 27281159) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001121128 |
Locus ID | 8048 |
UniProt ID | P50461 |
Cytogenetics | 11p15.1 |
Refseq Size | 1464 |
Refseq ORF | 582 |
Synonyms | CLP; CMD1M; CMH12; CRP3; LMO4; MLP |
Summary | This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418660 | CSRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426837 | CSRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418660 | Transient overexpression lysate of cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 1 |
USD 436.00 |
|
LY426837 | Transient overexpression lysate of cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2 |
USD 436.00 |
|
PH325217 | CSRP3 MS Standard C13 and N15-labeled recombinant protein (NP_001121128) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review