PKMYT1 (NM_004203) Human Recombinant Protein

SKU
TP322657
Recombinant protein of human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222657 representing NM_004203
Red=Cloning site Green=Tags(s)

MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPR
TPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKR
SMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQV
WGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQ
GSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATA
EALLALPVLRQPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLS
LFEDTLDPT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004194
Locus ID 9088
UniProt ID Q99640
Cytogenetics 16p13.3
RefSeq Size 2121
RefSeq ORF 1497
Synonyms MYT1; PPP1R126
Summary This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. The activity of the encoded protein is regulated by polo-like kinase 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation
Write Your Own Review
You're reviewing:PKMYT1 (NM_004203) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322657 PKMYT1 MS Standard C13 and N15-labeled recombinant protein (NP_004194) 10 ug
$3,255.00
LC401358 PKMYT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401358 Transient overexpression lysate of protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.