CNN2 (NM_004368) Human Recombinant Protein

SKU
TP321104
Recombinant protein of human calponin 2 (CNN2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221104 representing NM_004368
Red=Cloning site Green=Tags(s)

MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG
SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV
DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM
GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA
DGAPSGTGDCPDPGEVPEYPPYYQEEAGY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004359
Locus ID 1265
UniProt ID Q99439
Cytogenetics 19p13.3
RefSeq Size 2478
RefSeq ORF 927
Summary The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]
Write Your Own Review
You're reviewing:CNN2 (NM_004368) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312208 CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_958434) 10 ug
$3,255.00
PH321104 CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359) 10 ug
$3,255.00
LC404509 CNN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418024 CNN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404509 Transient overexpression lysate of calponin 2 (CNN2), transcript variant 2 100 ug
$436.00
LY418024 Transient overexpression lysate of calponin 2 (CNN2), transcript variant 1 100 ug
$436.00
TP312208 Purified recombinant protein of Homo sapiens calponin 2 (CNN2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.