SRA1 (NM_001035235) Human Recombinant Protein

CAT#: TP320899M

Recombinant protein of human steroid receptor RNA activator 1 (SRA1), 100 µg

Product Images

Coomassie blue staining of purified SRA1 protein (Cat# TP320899). The protein was produced from HEK293T cells transfected with SRA1 cDNA clone (Cat# RC220899) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220899 representing NM_001035235
  Red=Cloning site Green=Tags(s)
  
  MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSP
  GPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRR
  LALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFS
  EEAANEEKSAATAEKNHTIPGFQQAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001030312
• Locus ID: 10011
• UniProt ID: Q9HD15
• Cytogenetics: 5q31.3
• Refseq Size: 1534
• Refseq ORF: 1991
• Synonyms: pp7684; SRA; SRAP; STRAA1
• Summary: Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA. [provided by RefSeq, Mar 2012]