Natriuretic Peptide Receptor C (NPR3) (NM_000908) Human Recombinant Protein
CAT#: TP319453
Recombinant protein of human natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) (NPR3), 20 µg
View other "Natriuretic Peptide Receptor C" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219453 representing NM_000908
Red=Cloning site Green=Tags(s) MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLT RVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLE RNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT SGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNM EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSCGLEESAVTGIVVGA LLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSVA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000899 |
Locus ID | 4883 |
UniProt ID | P17342, Q60I31 |
Cytogenetics | 5p13.3 |
Refseq Size | 2651 |
Refseq ORF | 1620 |
Synonyms | ANP-C; ANPR-C; ANPRC; C5orf23; GUCY2B; NPR-C; NPRC |
Summary | This gene encodes one of three natriuretic peptide receptors. Natriutetic peptides are small peptides which regulate blood volume and pressure, pulmonary hypertension, and cardiac function as well as some metabolic and growth processes. The product of this gene encodes a natriuretic peptide receptor responsible for clearing circulating and extracellular natriuretic peptides through endocytosis of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424462 | NPR3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY424462 | Transient overexpression lysate of natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) (NPR3) |
USD 665.00 |
|
PH319453 | NPR3 MS Standard C13 and N15-labeled recombinant protein (NP_000899) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review