NY-ESO-1 (CTAG1A) (NM_139250) Human Recombinant Protein

CAT#: TP316285

Reviews ()
Write a review

Recombinant protein of human cancer/testis antigen 1A (CTAG1A)

Size: 20 ug 100 ug 1 mg



  View other "CTAG1A" proteins (3)

USD 867.00

In Stock*

Size
    • 20 ug

Product images

Frequently bought together (2)
Rabbit Polyclonal Anti-CTAG1A/B Antibody
    • 25 ul

USD 800.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "CTAG1A"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC216285 protein sequence
Red=Cloning site Green=Tags(s)

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS
GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA
DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.8 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_640343
Locus ID 246100
UniProt ID P78358
Cytogenetics Xq28
Refseq Size 748
Refseq ORF 540
Synonyms CT6.1; ESO1; LAGE-2; LAGE2A; NY-ESO-1
Summary The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015]
Protein Families Druggable Genome

Documents

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.