POT1 (NM_015450) Human Recombinant Protein

CAT#: TP316275

Recombinant protein of human POT1 protection of telomeres 1 homolog (S. pombe) (POT1), transcript variant 1, 20 µg

Product Images

Western blotting using anti-H2ac, anti-TRF2, and anti-POT1 with or without H2ac, TRF2, and POT1 proteins (OriGene TP316275) as competitors. Tubulin served internal controls. Figure cited from PLoS ONE, PMID: 27228173

• 

  Purified recombinant HA-H2ac interacted directly with purified recombinant MYC-POT1 (OriGene TP316275), as analyzed by a pulldown assay and Western blot. HA-H2acS16A served as a negative control. Figure cited from PLoS ONE, PMID: 27228173

• 

  Coomassie blue staining of purified POT1 protein (Cat# TP316275). The protein was produced from HEK293T cells transfected with POT1 cDNA clone (Cat# RC216275) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216275 representing NM_015450
  Red=Cloning site Green=Tags(s)
  
  MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALP
  IIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWA
  STHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHI
  HRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPE
  SNSDVDQLKKDLESANLTANQHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLCA
  ILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPVVKLQNTSLYD
  SKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSA
  PFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLM
  DSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVA
  EDVI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 71.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: EMSA assay (PMID: 25934589)
  Binding assay (competitor) (PMID: 27228173)
  Pull-down assay (PMID: 27228173)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056265
• Locus ID: 25913
• UniProt ID: Q9NUX5, A0A024R739
• Cytogenetics: 7q31.33
• Refseq Size: 2631
• Refseq ORF: 1902
• Synonyms: CMM10; GLM9; HPOT1
• Summary: This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008]