Growth Arrest Specific Protein 7 (GAS7) (NM_003644) Human Recombinant Protein

SKU
TP315256
Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant a, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215256 representing NM_003644
Red=Cloning site Green=Tags(s)

MSNMENSFDDVSCLSPQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD
PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK
SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL
EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR
QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003635
Locus ID 8522
UniProt ID O60861
Cytogenetics 17p13.1
RefSeq Size 7773
RefSeq ORF 1008
Summary Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Growth Arrest Specific Protein 7 (GAS7) (NM_003644) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300285 GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836) 10 ug
$3,255.00
PH315256 GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635) 10 ug
$3,255.00
LC404414 GAS7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404415 GAS7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418527 GAS7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404414 Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant b 100 ug
$436.00
LY404415 Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant c 100 ug
$665.00
LY418527 Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant a 100 ug
$436.00
TP300285 Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720200 Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant d 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.