OPA1 (NM_130832) Human Recombinant Protein
CAT#: TP311417
Recombinant protein of human optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211417 representing NM_130832
Red=Cloning site Green=Tags(s) MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQQFSSLTNLPL RKLKFSPIKYGYQPRRNFWPARLATRLLKLRYLILGSAVGGGYTAKKTFDQWKDMIPDLSEYKWIVPDIV WEIDEYIDFGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLK YQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQS AGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMR KNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQD GSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGYFAVVTGKGNS SESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEW KNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGT FNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFA EDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVH NETKNELEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCNLCRR GFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLL TGKRVQLAEDLKKVREIQEKLDAFIEALHQEK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 109.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Applications | Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570845 |
Locus ID | 4976 |
UniProt ID | E5KLK0 |
Cytogenetics | 3q29 |
Refseq Size | 6291 |
Refseq ORF | 2826 |
Synonyms | BERHS; largeG; MGM1; MTDPS14; NPG; NTG |
Summary | The protein encoded by this gene is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. The encoded protein localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. [provided by RefSeq, Aug 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408906 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC408908 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC408909 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC408910 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC408911 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC414474 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408906 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 665.00 |
|
LY408908 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 665.00 |
|
LY408909 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 5 |
USD 665.00 |
|
LY408910 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 6 |
USD 665.00 |
|
LY408911 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 7 |
USD 665.00 |
|
LY414474 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
PH311417 | OPA1 MS Standard C13 and N15-labeled recombinant protein (NP_570845) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review