NIT2 (NM_020202) Human Recombinant Protein

CAT#: TP310660L

Recombinant protein of human nitrilase family, member 2 (NIT2), 1 mg

Product Images

The specific activity of different substrates of human Nit 2 (OriGene TP310660). a: the number of replicates is shown in parenthesis. Figure cited from Biology (Basel), PMID: 28358347

• 

  Coomassie blue staining of purified NIT2 protein (Cat# TP310660). The protein was produced from HEK293T cells transfected with NIT2 cDNA clone (Cat# RC210660) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210660 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS
  EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST
  FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR
  DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Enzyme activity (PMID: 28358347)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064587
• Locus ID: 56954
• UniProt ID: Q9NQR4, V9HW91
• Cytogenetics: 3q12.2
• Refseq Size: 1271
• Refseq ORF: 828
• Synonyms: HEL-S-8a
• Summary: Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.[UniProtKB/Swiss-Prot Function]